PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA233G00002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family GATA
Protein Properties Length: 306aa    MW: 34503.7 Da    PI: 9.7246
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA233G00002genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20225259135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  AA233G00002 225 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 259
                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.215219255IPR000679Zinc finger, GATA-type
SMARTSM004013.3E-19219269IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.66E-15220282No hitNo description
Gene3DG3DSA:3.30.50.102.4E-15223256IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.17E-17224273No hitNo description
PROSITE patternPS003440225250IPR000679Zinc finger, GATA-type
PfamPF003202.6E-18225259IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MNNGSWLHEE DFKGLSDDFF DDLINQIDFP LEDIETETPN GEGDWEARFQ ELEPPPMDMF  60
PTLPSEFTSA RIIKGGRFGV HKTIPILKQS SSSEAFSDTN SSLHQSSLPP DIKVSKLFQS  120
SSPVSVFESS YGSLSSQISR SQRLSFPVKG IRSKRKRPTT LKFRNLLPFE PRKPEKLTPV  180
ESESESYYSS ELFGKKKRKK HKTHQTHTVY SSSSSTNSDG ISRKCTHCET TKTPQWREGP  240
NGPKTLCNAC GVRFRSGRLV PEYRPASSPT FIPSVHSNSH RKIVEMRRKG GDQFDTGMIH  300
AVISRA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195199KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304051.11e-155hypothetical protein CARUB_v10009871mg
RefseqXP_006304052.11e-155hypothetical protein CARUB_v10009871mg
SwissprotQ6DBP81e-147GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF881e-155R0IF88_9BRAS; Uncharacterized protein
STRINGAT1G08010.11e-145(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-112GATA transcription factor 11